Structure of PDB 6wg6 Chain C Binding Site BS01

Receptor Information
>6wg6 Chain C (length=182) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRQQRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDA
IIVDSEKTGRDCIQYIKEQRGEPETFLPLDYLEVKPTDEKLRELKGAKLV
IDVIRYEPPHIKKALQYACGNALVCDNVEDARRIAFGGHQRHKTVALDGT
LFQKSGVISGGASDLKAKARRWDEKAVDKLKE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6wg6 Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
Resolution3.54 Å
Binding residue
(original residue number in PDB)
R599 Y600 P603 K606
Binding residue
(residue number reindexed from 1)
R105 Y106 P109 K112
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0051276 chromosome organization
Cellular Component
GO:0005694 chromosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6wg6, PDBe:6wg6, PDBj:6wg6
PDBsum6wg6
PubMed32409525
UniProtQ14683|SMC1A_HUMAN Structural maintenance of chromosomes protein 1A (Gene Name=SMC1A)

[Back to BioLiP]