Structure of PDB 6vbq Chain C Binding Site BS01

Receptor Information
>6vbq Chain C (length=223) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGAEVKKPGASVKLSCKASGYTFTDYYIHWVRQAPGQGLEWMGI
INPRRDTTTYAQKFQGRVTMTRDTSTNTVYMELSSLRSDDTAVYFCAKNV
GFCNSDSCYVGMDVWGPGTTVTISSASTKGPSVFPLAPSSSGGTAALGCL
VKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGT
QTYICNVNHKPSNTKVDKRVEPK
Ligand information
>6vbq Chain K (length=13) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KKQKVHALFYKLD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6vbq HIV vaccine delayed boosting increases Env variable region 2-specific antibody effector functions.
Resolution2.116 Å
Binding residue
(original residue number in PDB)		Y33 T56 N100 S100A D100B S100C C100D V100F
Binding residue
(residue number reindexed from 1)		Y33 T57 N104 S105 D106 S107 C108 V110
External links