Structure of PDB 6ulq Chain C Binding Site BS01

Receptor Information
>6ulq Chain C (length=118) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQP
MDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLE
KIFLQKVASMPQEEQELV
Ligand information
>6ulq Chain E (length=15) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WKGYLCLRKRIQRTY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ulq Cyclic peptides can engage a single binding pocket through highly divergent modes.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		W97 V103 K107 L108 D161 M165
Binding residue
(residue number reindexed from 1)		W27 V33 K37 L38 D91 M95
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6ulq, PDBe:6ulq, PDBj:6ulq
PDBsum6ulq
PubMed33046654
UniProtP25440|BRD2_HUMAN Bromodomain-containing protein 2 (Gene Name=BRD2)

[Back to BioLiP]