Structure of PDB 6tyi Chain C Binding Site BS01

Receptor Information
>6tyi Chain C (length=226) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKRE
QQLLAEARSLNQANDIAADFGSKSLSLHLLNEAQNELELSEGSDDNEGIK
ERTSFRLERRVAAVGRQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIG
IAQTQTTNLAVVAPGIAEALLATAIGLVAAIPAVVIYNVFARQIGGFKAM
LGDVAAQVLLLQSRDLDLEASAAAHP
Ligand information
>6tyi Chain Z (length=29) Species: 83333 (Escherichia coli K-12) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NGEMHDINVTPFIDVMLVLLIIFMVAAPL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tyi Cryo-EM structure of the bacterial Ton motor subcomplex ExbB-ExbD provides information on structure and stoichiometry.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		A134 G137 F142 L145 I152 F156 L167 I174 Y195
Binding residue
(residue number reindexed from 1)		A126 G129 F134 L137 I144 F148 L159 I166 Y187
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0022857 transmembrane transporter activity
GO:0031992 energy transducer activity
GO:0042802 identical protein binding
Biological Process
GO:0006879 intracellular iron ion homeostasis
GO:0015031 protein transport
GO:0015889 cobalamin transport
GO:0017038 protein import
GO:0030003 intracellular monoatomic cation homeostasis
GO:0042928 ferrichrome import into cell
GO:0043213 bacteriocin transport
GO:0050821 protein stabilization
GO:0055085 transmembrane transport
Cellular Component
GO:0005886 plasma membrane
GO:0009279 cell outer membrane
GO:0016020 membrane
GO:0098797 plasma membrane protein complex
GO:1902495 transmembrane transporter complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tyi, PDBe:6tyi, PDBj:6tyi
PDBsum6tyi
PubMed31602407
UniProtP0ABU7|EXBB_ECOLI Biopolymer transport protein ExbB (Gene Name=exbB)

[Back to BioLiP]