Structure of PDB 6t1f Chain C Binding Site BS01

Receptor Information

>6t1f Chain C (length=195) Species: 565050 (Caulobacter vibrioides NA1000) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SREAPIEILQRNPDQPRRTFREEDLEDLSNSIREKGVLQPILVRPSPDTA
GEYQIVAGERRWRAAQRAGLKTVPIMVRELDDLAVLEIGIIENVQRADLN
VLEEALSYKVLMEKFERTQENIAQTIGKSRSHVANTMRLLALPDEVQSYL
VSGELTAGHARAIAAAADPVALAKQIIEGGLSVRETEALARKAPN

Ligand information

>6t1f Chain G (length=22) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ggatgtttcacgtgaaacatcc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6t1f A CTP-dependent gating mechanism enables ParB spreading on DNA.
Resolution	2.9 Å
Binding residue (original residue number in PDB)	T161 Q162 R173 N178 R181 A208 R227 E230 R234
Binding residue (residue number reindexed from 1)	T118 Q119 R130 N135 R138 A165 R184 E187 R191

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

View graph for
Molecular Function

External links

PDB	RCSB:6t1f, PDBe:6t1f, PDBj:6t1f
PDBsum	6t1f
PubMed	34397383
UniProt	B8GW30\|PARB_CAUVN Chromosome-partitioning protein ParB (Gene Name=parB)

[Back to BioLiP]