Structure of PDB 6t0w Chain C Binding Site BS01

Receptor Information
>6t0w Chain C (length=86) Species: 11520 (Influenza B virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NPSLRMKWAMCSNFPLALTKGDMANRIPLEYKGIQLKTNAEDIGTKGQMC
SIAAVTWWNTYGPIGDTEGFERVYESFFLRKMRLDN
Ligand information
>6t0w Chain V (length=25) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aguaguaacaagaggccucucugcu
.<<....>>.<<<<..>>>>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6t0w A Structure-Based Model for the Complete Transcription Cycle of Influenza Polymerase.
Resolution3.18 Å
Binding residue
(original residue number in PDB)		C54 N56
Binding residue
(residue number reindexed from 1)		C11 N13
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003968 RNA-dependent RNA polymerase activity
Biological Process
GO:0001172 RNA-templated transcription
GO:0006351 DNA-templated transcription
GO:0006370 7-methylguanosine mRNA capping
GO:0019083 viral transcription
GO:0039523 symbiont-mediated suppression of host mRNA transcription via inhibition of RNA polymerase II activity
GO:0039694 viral RNA genome replication
GO:0075526 cap snatching
Cellular Component
GO:0033650 host cell mitochondrion
GO:0042025 host cell nucleus
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6t0w, PDBe:6t0w, PDBj:6t0w
PDBsum6t0w
PubMed32304664
UniProtQ5V8X3

[Back to BioLiP]