Structure of PDB 6t0s Chain C Binding Site BS01

Receptor Information
>6t0s Chain C (length=249) Species: 1129347 (Influenza A virus (A/little yellow-shouldered bat/Guatemala/060/2010(H17N10))) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGMERIKELMEMVKNSRMREILTTTSVDHMAVIKKYTSGRQEKNPALRMK
WMMAMKYPISASSRIREMIPEKDEDGNTLWTNTKDAGSNRVLVSPNAVTW
WNRAGPVSDVVHYPRVYKMYFDRLERLTHGTFGPVKFYNQVKVRKRVDIN
PGHKDLTSREAQEVIMEVVFPNEVGARTLSSDAQLTITKEKKEELKNCKI
SPIMVAYMLERELVRRTRFLPIAGATSSTYVEVLHLTQGTCWEQQYTPG
Ligand information
>6t0s Chain V (length=33) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aguaguaacaagauuuuuuccgucucuucugcu
.<<....>>........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6t0s A Structure-Based Model for the Complete Transcription Cycle of Influenza Polymerase.
Resolution3.04 Å
Binding residue
(original residue number in PDB)		K41 M53 K54 S58 R88 S199 I201 R216
Binding residue
(residue number reindexed from 1)		K43 M55 K56 S60 R90 S201 I203 R218
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006351 DNA-templated transcription
GO:0006370 7-methylguanosine mRNA capping
GO:0019083 viral transcription
GO:0039523 symbiont-mediated suppression of host mRNA transcription via inhibition of RNA polymerase II activity
GO:0075526 cap snatching
Cellular Component
GO:0033650 host cell mitochondrion
GO:0042025 host cell nucleus
GO:0044423 virion component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6t0s, PDBe:6t0s, PDBj:6t0s
PDBsum6t0s
PubMed32304664
UniProtH6QM90

[Back to BioLiP]