Structure of PDB 6syf Chain C Binding Site BS01

Receptor Information
>6syf Chain C (length=156) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGAAGT
PWAGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDK
DWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYAQNRVEYEKRVRAQ
AKKFAP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6syf Lysine acylation using conjugating enzymes for site-specific modification and ubiquitination of recombinant proteins.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		N85 C93 L94 S95 I96 E98 D102 E118 N124 D127
Binding residue
(residue number reindexed from 1)		N84 C92 L93 S94 I95 E97 D101 E117 N123 D126
Enzymatic activity
Enzyme Commision number 2.3.2.-
Gene Ontology
Molecular Function
GO:0001221 transcription coregulator binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008134 transcription factor binding
GO:0016740 transferase activity
GO:0019787 ubiquitin-like protein transferase activity
GO:0019789 SUMO transferase activity
GO:0019899 enzyme binding
GO:0044388 small protein activating enzyme binding
GO:0061656 SUMO conjugating enzyme activity
GO:0071535 RING-like zinc finger domain binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0007059 chromosome segregation
GO:0007084 mitotic nuclear membrane reassembly
GO:0016925 protein sumoylation
GO:0030335 positive regulation of cell migration
GO:0032446 protein modification by small protein conjugation
GO:0036211 protein modification process
GO:0045892 negative regulation of DNA-templated transcription
GO:0051168 nuclear export
GO:0051301 cell division
GO:1903755 positive regulation of SUMO transferase activity
Cellular Component
GO:0000795 synaptonemal complex
GO:0005634 nucleus
GO:0005635 nuclear envelope
GO:0005643 nuclear pore
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016605 PML body
GO:0048471 perinuclear region of cytoplasm
GO:0106068 SUMO ligase complex
GO:1990234 transferase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6syf, PDBe:6syf, PDBj:6syf
PDBsum6syf
PubMed32929246
UniProtP63279|UBC9_HUMAN SUMO-conjugating enzyme UBC9 (Gene Name=UBE2I)

[Back to BioLiP]