Structure of PDB 6sqn Chain C Binding Site BS01

Receptor Information
>6sqn Chain C (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMR
GQAWVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sqn Expanding crystallization tools for nucleic acid complexes using U1A protein variants.
Resolution2.05 Å
Binding residue
(original residue number in PDB)		Y13 N15 N16 E19 K22 K50 M51 R52 Q54 W56 K80 Q85 K88 T89 D90 S91 D92
Binding residue
(residue number reindexed from 1)		Y11 N13 N14 E17 K20 K48 M49 R50 Q52 W54 K78 Q83 K86 T87 D88 S89 D90
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6sqn, PDBe:6sqn, PDBj:6sqn
PDBsum6sqn
PubMed32070773
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]