Structure of PDB 6sok Chain C Binding Site BS01

Receptor Information
>6sok Chain C (length=122) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EAGITGTWYNQLGSTFIVTAGADGALTGTYVTARGNAESRYVLTGRYDSA
PATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSG
TTEANAWKSTLVGHDTFTKVKP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6sok The Role of Changing Loop Conformations in Streptavidin Versions Engineered for High-affinity Binding of the Strep-tag II Peptide.
Resolution1.96 Å
Binding residue
(original residue number in PDB)		T45 R47 Y54 W79 R84 S88 T90 W108 L110
Binding residue
(residue number reindexed from 1)		T32 R34 Y41 W66 R71 S75 T77 W95 L97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:6sok, PDBe:6sok, PDBj:6sok
PDBsum6sok
PubMed33639211
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]