Structure of PDB 6scf Chain C Binding Site BS01

Receptor Information
>6scf Chain C (length=112) Species: 157898 (Sulfolobus islandicus rod-shaped virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NKVYLANAFSINMLTKFPTKVVIDKIDRLEFCENIDNEDIINSIGADSTI
QLINSLCGTTFQKNRVEIKLEKEDKLYVVQISQRLEEGKILTLEEILKLY
ESGKVQFFEIIV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6scf An anti-CRISPR viral ring nuclease subverts type III CRISPR immunity.
Resolution1.55 Å
Binding residue
(original residue number in PDB)
N8 A9 S11 N13 M14 T50 R66 E68 I69 Q81 I82 R85 L92
Binding residue
(residue number reindexed from 1)
N7 A8 S10 N12 M13 T49 R65 E67 I68 Q80 I81 R84 L91
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6scf, PDBe:6scf, PDBj:6scf
PDBsum6scf
PubMed31942067
UniProtQ8QL27|Y114_SIRV1 Uncharacterized protein 114 (Gene Name=114)

[Back to BioLiP]