Structure of PDB 6ryi Chain C Binding Site BS01

Receptor Information
>6ryi Chain C (length=60) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRWTPTTEQIKILKELYYNNAIRSPTADQIQKITARLRQFGKIEGKNVFY
WFQNHKARER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ryi Structural basis for the complex DNA binding behavior of the plant stem cell regulator WUSCHEL.
Resolution2.691 Å
Binding residue
(original residue number in PDB)
R38 W39 N83 Y86 N90
Binding residue
(residue number reindexed from 1)
R2 W3 N47 Y50 N54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0099402 plant organ development

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:6ryi, PDBe:6ryi, PDBj:6ryi
PDBsum6ryi
PubMed32376862
UniProtQ9SB92|WUS_ARATH Protein WUSCHEL (Gene Name=WUS)

[Back to BioLiP]