Structure of PDB 6roz Chain C Binding Site BS01

Receptor Information
>6roz Chain C (length=102) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVT
HIKIQNTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPL
NC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6roz Molecular mechanism of SHP2 activation by PD-1 stimulation.
Resolution2.89 Å
Binding residue
(original residue number in PDB)
R32 S34 K35 S36 T42 H53 G67 G68 K89 E90 K91
Binding residue
(residue number reindexed from 1)
R30 S32 K33 S34 T40 H51 G65 G66 K87 E88 K89
Enzymatic activity
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
External links
PDB RCSB:6roz, PDBe:6roz, PDBj:6roz
PDBsum6roz
PubMed32064351
UniProtQ06124|PTN11_HUMAN Tyrosine-protein phosphatase non-receptor type 11 (Gene Name=PTPN11)

[Back to BioLiP]