Structure of PDB 6rny Chain C Binding Site BS01

Receptor Information
>6rny Chain C (length=110) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYL
TAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVL
PNIQAVLLPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6rny Retroviral integration into nucleosomes through DNA looping and sliding along the histone octamer.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		R11 R17 G28 R29 R32 R77
Binding residue
(residue number reindexed from 1)		R3 R9 G20 R21 R24 R69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0008150 biological_process
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6rny, PDBe:6rny, PDBj:6rny
PDBsum6rny
PubMed31519882
UniProtP0C0S8|H2A1_HUMAN Histone H2A type 1 (Gene Name=H2AC11)

[Back to BioLiP]