Structure of PDB 6qua Chain C Binding Site BS01

Receptor Information
>6qua Chain C (length=112) Species: 64091 (Halobacterium salinarum NRC-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DARDLTAFQKNILTVLGEEARYGLAIKRELEEYYGEEVNHGRLYPNLDDL
VNKGLVEKSELDKRTNEYALTNEGFDAVVDDLEWTLSKFVADADRRERVE
TIVADDAAALEH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qua Specificity of protein-DNA interactions in hypersaline environment: structural studies on complexes of Halobacterium salinarum oxidative stress-dependent protein hsRosR.
Resolution2.681 Å
Binding residue
(original residue number in PDB)		Y32 G33 L34 H50 Y54 K68 R74 T75 N76
Binding residue
(residue number reindexed from 1)		Y22 G23 L24 H40 Y44 K58 R64 T65 N66
Binding affinityPDBbind-CN: Kd=177.55nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:6qua, PDBe:6qua, PDBj:6qua
PDBsum6qua
PubMed31310308
UniProtQ9HSF4

[Back to BioLiP]