Structure of PDB 6qh1 Chain C Binding Site BS01

Receptor Information
>6qh1 Chain C (length=242) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LEARFQQAALLKKLLDAIKELVTDANFDCNDNGISLQAMDSSHVALVSML
IKSDGFEPYRCDRNIALGINLNALSKVLRCAQNEDLVTLKAEDTPEVLNL
VFESEDRISDYDVKLMDIDQEHLGIPDIEYDATITMPAAEFQRITRDLLT
LSDSVTINASKEGVRFSCKGDIGNGSTTLKQHSIEISLTQAVTLTFSLKY
LAQFTKATPLATRVTLSMSNDVPLLVEYKMESGFLRFYLAPK
Ligand information
>6qh1 Chain D (length=10) Species: 4896 (Schizosaccharomyces pombe) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IQGSLMDVGM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qh1 The structure of Schizosaccharomyces pombe PCNA in complex with an Spd1 derived peptide
Resolution2.9 Å
Binding residue
(original residue number in PDB)		H44 V45 D232 P234 A251 K253
Binding residue
(residue number reindexed from 1)		H43 V44 D221 P223 A240 K242
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030337 DNA polymerase processivity factor activity
Biological Process
GO:0006260 DNA replication
GO:0006271 DNA strand elongation involved in DNA replication
GO:0006272 leading strand elongation
GO:0006275 regulation of DNA replication
GO:0006281 DNA repair
GO:0006298 mismatch repair
GO:0006301 postreplication repair
GO:0019985 translesion synthesis
GO:0042276 error-prone translesion synthesis
GO:0045739 positive regulation of DNA repair
GO:0045740 positive regulation of DNA replication
GO:0070914 UV-damage excision repair
GO:0070987 error-free translesion synthesis
GO:0140861 DNA repair-dependent chromatin remodeling
GO:1900264 positive regulation of DNA-directed DNA polymerase activity
GO:1903459 mitotic DNA replication lagging strand elongation
GO:1903460 mitotic DNA replication leading strand elongation
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005829 cytosol
GO:0035861 site of double-strand break
GO:0043596 nuclear replication fork
GO:0043626 PCNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6qh1, PDBe:6qh1, PDBj:6qh1
PDBsum6qh1
PubMed
UniProtQ03392|PCNA_SCHPO Proliferating cell nuclear antigen (Gene Name=pcn1)

[Back to BioLiP]