Structure of PDB 6qh0 Chain C Binding Site BS01

Receptor Information
>6qh0 Chain C (length=110) Species: 64091 (Halobacterium salinarum NRC-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARDLTAFQKNILTVLGEEARYGLAIKRELEEYYGEEVNHGRLYPNLDDLV
NKGLVEKSELDKRTNEYALTNEGFDAVVDDLEWTLSKFVADADRRERVET
IVADDAAALE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6qh0 Specificity of protein-DNA interactions in hypersaline environment: structural studies on complexes of Halobacterium salinarum oxidative stress-dependent protein hsRosR.
Resolution2.436 Å
Binding residue
(original residue number in PDB)		Y32 G33 L34 H50 Y54 R74 T75 N76
Binding residue
(residue number reindexed from 1)		Y21 G22 L23 H39 Y43 R63 T64 N65
Binding affinityPDBbind-CN: Kd=99.46nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:6qh0, PDBe:6qh0, PDBj:6qh0
PDBsum6qh0
PubMed31310308
UniProtQ9HSF4

[Back to BioLiP]