Structure of PDB 6q5y Chain C Binding Site BS01

Receptor Information
>6q5y Chain C (length=148) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NFIWKGFINMPSVAKFVTKAYPVSGSPEYLTEDLPDSIQVGGRISPQTVW
DYVEKIKASGTKEICVVRFTPVTEEDQISYTLLFAYFSSRKRYGVAANNM
KQVKDMYLIPLGATDKIPHPLVPFDGPGLELHRPNLLLGLIIRQKLKR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6q5y PHF3 regulates neuronal gene expression through the new Pol II CTD reader domain SPOC
Resolution2.85 Å
Binding residue
(original residue number in PDB)
G1246 G1247 R1248 I1249 Y1257 K1260 K1309 Y1312
Binding residue
(residue number reindexed from 1)
G41 G42 R43 I44 Y52 K55 K104 Y107
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6q5y, PDBe:6q5y, PDBj:6q5y
PDBsum6q5y
PubMed
UniProtQ92576|PHF3_HUMAN PHD finger protein 3 (Gene Name=PHF3)

[Back to BioLiP]