Structure of PDB 6psd Chain C Binding Site BS01

Receptor Information
>6psd Chain C (length=72) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLVMLRKAQEFFQTCDAEGKGFIARKDMQRLHKELPLSLEELEDVFDALD
ADGNGYLTPQEFTTGFSHFFFS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6psd A tunable LIC1-adaptor interaction modulates dynein activity in a cargo-specific manner.
Resolution2.66 Å
Binding residue
(original residue number in PDB)		F58 L82 L84 F113 F116
Binding residue
(residue number reindexed from 1)		F11 L35 L37 F66 F69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:6psd, PDBe:6psd, PDBj:6psd
PDBsum6psd
PubMed33173051
UniProtQ9BSW2|EFC4B_HUMAN EF-hand calcium-binding domain-containing protein 4B (Gene Name=CRACR2A)

[Back to BioLiP]