Structure of PDB 6pbw Chain C Binding Site BS01

Receptor Information

>6pbw Chain C (length=211) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SALTQPDSVSGSPGQSITISCTGTSNDVGIYNHVSWYQQHPGKAPKLMIY
DVNKRPSGISNRFSGSKSGDTASLTISGLQAEDEADYYCCSYAGSSAWVF
GGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVA
WKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTH
EGSTVEKTVAP

Ligand information

>6pbw Chain E (length=8) Species: 36329 (Plasmodium falciparum 3D7) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

NPNANPNA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6pbw Structure and mechanism of monoclonal antibody binding to the junctional epitope of Plasmodium falciparum circumsporozoite protein.
Resolution	2.058 Å
Binding residue (original residue number in PDB)	Y30 N31 H32 Y91 S95
Binding residue (residue number reindexed from 1)	Y31 N32 H33 Y92 S96

External links

PDB	RCSB:6pbw, PDBe:6pbw, PDBj:6pbw
PDBsum	6pbw
PubMed	32150583

[Back to BioLiP]