Structure of PDB 6p7n Chain C Binding Site BS01

Receptor Information
>6p7n Chain C (length=106) Species: 386891 (Moraxella bovoculi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IRACIIKEIDLYTEQLYNIIKSLPYDKRPNVVYSDQPLDPNNLDLSEPEL
WAEQVGECMRYAHNDQPCFYIGSTKRELRVNYIVPVIGVRDEIERVMTLE
EVRNLH
Ligand information
>6p7n Chain B (length=26) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aauuucuacuaaguguagauaaagug
....<<<<<.....>>>>>.......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6p7n Structural basis for AcrVA4 inhibition of specific CRISPR-Cas12a.
Resolution4.9 Å
Binding residue
(original residue number in PDB)		E184 M186 K202
Binding residue
(residue number reindexed from 1)		E57 M59 K75
External links