Structure of PDB 6om3 Chain C Binding Site BS01

Receptor Information
>6om3 Chain C (length=104) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILE
LAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSV
LLPK
Ligand information
>6om3 Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcgagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacggattctcccccgcgttttaaccgccaaggg
gattactccctagtctccaggcacgtgtcagatatatacatccgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6om3 Structure and function of the Orc1 BAH-nucleosome complex.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		R29 R42 V43 G44 K75 T76 R77
Binding residue
(residue number reindexed from 1)		R15 R28 V29 G30 K61 T62 R63
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6om3, PDBe:6om3, PDBj:6om3
PDBsum6om3
PubMed31263106
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]