Structure of PDB 6od5 Chain C Binding Site BS01

Receptor Information
>6od5 Chain C (length=59) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRMANNARERLRVRDINEAFKELGRMVQLHLKSDKPQTKLLILHQAVAVI
LSLEQQVRE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6od5 Structural basis for preferential binding of human TCF4 to DNA containing 5-carboxylcytosine.
Resolution2.05 Å
Binding residue
(original residue number in PDB)		E577 R580
Binding residue
(residue number reindexed from 1)		E9 R12
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:6od5, PDBe:6od5, PDBj:6od5
PDBsum6od5
PubMed31081034
UniProtP15884|ITF2_HUMAN Transcription factor 4 (Gene Name=TCF4)

[Back to BioLiP]