Structure of PDB 6o7i Chain C Binding Site BS01

Receptor Information
>6o7i Chain C (length=275) Species: 523850 (Thermococcus onnurineus NA1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RFYGKIVIKGKIKAVTGLHIGSQDNPVIKDPHTGLPYIPGSSLKGRLRSL
FEILVNSRLGEWREKYPSLANYSPGSCRPDNQENCGKFFNRKINRGWIHV
CPDYETALACPVCRLFGASGKESNFPSRIIVRDAFLTKEWEEKWRAGEAI
TEAKIEVGIDRVTSQANPRTNERVVAGAEFEFEIIYNVENTTHWRDDIKN
LLTAMALLEDSYLGGSGSRGYGKVKFIFDSFEFRPLDYYRTGKDEDIVSI
DAREKSVSDILSGFDSLFSEVEGKL
Ligand information
>6o7i Chain G (length=26) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guggaaaggcgggcagaggcgguuug
..........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6o7i Second Messenger cA4Formation within the Composite Csm1 Palm Pocket of Type III-A CRISPR-Cas Csm Complex and Its Release Path.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		I23 Q26 S54 K56 G57 R58 R60 S61 I105 G129 A130 S131 S139 I167 E168 V169 I171 R173 S176 A178 R181 Y224 G226 G227 R231
Binding residue
(residue number reindexed from 1)		I20 Q23 S42 K44 G45 R46 R48 S49 I93 G117 A118 S119 S127 I155 E156 V157 I159 R161 S164 A166 R169 Y212 G214 G215 R219
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6o7i, PDBe:6o7i, PDBj:6o7i
PDBsum6o7i
PubMed31326272
UniProtB6YWC0

[Back to BioLiP]