Structure of PDB 6o7e Chain C Binding Site BS01

Receptor Information
>6o7e Chain C (length=278) Species: 523850 (Thermococcus onnurineus NA1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RFYGKIVIKGKIKAVTGLHIGSQRGIDNPVIKDPHTGLPYIPGSSLKGRL
RSLFEILVNSRLGEWREKYPSLANYSPGSCRPDNQENCGKFFNRKINRGW
IHVCPDYETALACPVCRLFGASGKESNFPSRIIVRDAFLTKEWEEKWRAG
EAITEAKIEVGIDRVTSQANPRTNERVVAGAEFEFEIIYNVENTTHWRDD
IKNLLTAMALLEDSYLGGSGSRGYGKVKFIFDSFEFRPLDYYRTGKDEDI
VSIDAREKSVSDILSGFDSLFSEVEGKL
Ligand information
>6o7e Chain G (length=27) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guggaaaggcgggcagaggcgguuugc
...........................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6o7e Second Messenger cA4Formation within the Composite Csm1 Palm Pocket of Type III-A CRISPR-Cas Csm Complex and Its Release Path.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		G24 S53 S54 K56 G57 R58 R60 I105 G129 A130 S131 N136 F137 S139 E168 V169 G170 I171 R173 A178 R181 Y224 G226 G227 R231
Binding residue
(residue number reindexed from 1)		G21 S44 S45 K47 G48 R49 R51 I96 G120 A121 S122 N127 F128 S130 E159 V160 G161 I162 R164 A169 R172 Y215 G217 G218 R222
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6o7e, PDBe:6o7e, PDBj:6o7e
PDBsum6o7e
PubMed31326272
UniProtB6YWC0

[Back to BioLiP]