Structure of PDB 6o3g Chain C Binding Site BS01

Receptor Information
>6o3g Chain C (length=227) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVQSGGEVKRPGSSVTVSCKATGGTFSTLAFNWVRQAPGQGPEWMGG
IVPLFSIVNYGQKFQGRLTIRADKSTTTVFLDLSGLTSADTATYYCAREG
EGWFGKPLRAFEFWGQGTVITVSSASTKGPSVFPLAPSSKSTSGGTAALG
CLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSL
GTQTYICNVNHKPSNTKVDKKVEPKSC
Ligand information
>6o3g Chain Q (length=16) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NWFDITNWLWYIKKKK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6o3g An MPER antibody neutralizes HIV-1 using germline features shared among donors.
Resolution3.645 Å
Binding residue
(original residue number in PDB)		T31 L32 A33 N35 G50 I51 V52 I56 N58 E95 F100 G100A K100B P100C R100E
Binding residue
(residue number reindexed from 1)		T31 L32 A33 N35 G50 I51 V52 I57 N59 E99 F104 G105 K106 P107 R109
External links