Structure of PDB 6nvq Chain C Binding Site BS01

Receptor Information
>6nvq Chain C (length=244) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVP
TFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEM
TKEALPIKALEAVILGIYLTNSMPTLERFPISFKTYFSGNYFRHIVLGVN
FAGRYGALGMSRREDLMYKPPAFRTLSELVLDFEAAYGRCWHVLKKVKLG
QSVSHDPHSVEQIEWKHSVLDVERLGRDDFRKELERHARDMRLK
Ligand information
>6nvq Chain B (length=28) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SAQQELKQRQRAEIYALNRVMTELEQQQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6nvq Crystal structure of the tubulin tyrosine carboxypeptidase complex VASH1-SVBP.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		P68 V69 W74 V81 H85 I95 R96 G97 I104 P105 I106 L132 Y134 H136 F141 E163 A164 L165 P166
Binding residue
(residue number reindexed from 1)		P8 V9 W14 V21 H25 I35 R36 G37 I44 P45 I46 L72 Y74 H76 F81 E103 A104 L105 P106
Enzymatic activity
Enzyme Commision number 3.4.17.17: tubulinyl-Tyr carboxypeptidase.
Gene Ontology
Biological Process
GO:0045765 regulation of angiogenesis
Cellular Component
GO:0005737 cytoplasm

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6nvq, PDBe:6nvq, PDBj:6nvq
PDBsum6nvq
PubMed31270470
UniProtQ7L8A9|VASH1_HUMAN Tubulinyl-Tyr carboxypeptidase 1 (Gene Name=VASH1)

[Back to BioLiP]