Structure of PDB 6nud Chain C Binding Site BS01

Receptor Information
>6nud Chain C (length=212) Species: 1308 (Streptococcus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TFAKIKFSAQIRLETGLHIGGSDAFAAIGAIASPVIKDPITNIPIIPGSS
LKGKMRTLLAKVYNEKVAEKPSDDSDILSRLFGNSKDKRFKMGRLIFRDA
FLSNADELDSLGVRSYTEVKFENTIDRITAEANPRQIERAIRNSTFDFEL
IYEITDENENQVEEDFKVIRDGLKLLELDYLGGSGSRGYGKVAFEKLKAT
TVFGNYDVKTLN
Ligand information
>6nud Chain H (length=40) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acggaaacuuucguaacuguuuaauucuguucacuuauuc
........................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6nud Coupling of ssRNA cleavage with DNase activity in type III-A CRISPR-Csm revealed by cryo-EM and biochemistry.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		G21 G22 D24 K53 G54 K55 R57 P72 S73 F83 G84 N85 S86 K92 M93 F122 E123 N124 T125 R136 G184 R188
Binding residue
(residue number reindexed from 1)		G20 G21 D23 K52 G53 K54 R56 P71 S72 F82 G83 N84 S85 K91 M92 F121 E122 N123 T124 R135 G183 R187
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6nud, PDBe:6nud, PDBj:6nud
PDBsum6nud
PubMed30814678
UniProtA0A0A7HIF0|CSM3_STRTR CRISPR system Cms endoribonuclease Csm3 (Gene Name=csm3)

[Back to BioLiP]