Structure of PDB 6ntx Chain C Binding Site BS01

Receptor Information
>6ntx Chain C (length=34) Species: 11216 (Human respirovirus 3) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LDPIDISIVLNKIKSQLEESKEWIRRSNKILDSI
Ligand information
>6ntx Chain D (length=27) Species: 11216 (Human respirovirus 3) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
IVLNKIKSQLEESKEWIRRSNKILDSI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ntx Dual Inhibition of Human Parainfluenza Type 3 and Respiratory Syncytial Virus Infectivity with a Single Agent.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
D452 I484
Binding residue
(residue number reindexed from 1)
D2 I34
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6ntx, PDBe:6ntx, PDBj:6ntx
PDBsum6ntx
PubMed31268705
UniProtP06828|FUS_PI3H4 Fusion glycoprotein F0 (Gene Name=F)

[Back to BioLiP]