Structure of PDB 6njg Chain C Binding Site BS01

Receptor Information
>6njg Chain C (length=76) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQIFVQTITVMRIALEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGMQL
EDGRTLSDYNIKRDSNLYLVSSLRSL
Ligand information
>6njg Chain B (length=17) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YPEDEEELIRKAIELSL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6njg Dimerization of a ubiquitin variant leads to high affinity interactions with a ubiquitin interacting motif.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		Q6 R42 A46 G47 S72 L73
Binding residue
(residue number reindexed from 1)		Q6 R42 A46 G47 S72 L73
Enzymatic activity
Enzyme Commision number ?
External links