Structure of PDB 6nid Chain C Binding Site BS01

Receptor Information
>6nid Chain C (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRVRLVQFQKNTDEPMGITLKMNELNHCIVARIMHGGMIHRQGTLHVGDE
IREINGISVANQTVEQLQKMLREMRGSITFKIVPSY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6nid CASK PDZ domain specificity
Resolution1.86 Å
Binding residue
(original residue number in PDB)		P500 M501 G502 I503 T504 L505 K506 R517 M519 V549 Q553
Binding residue
(residue number reindexed from 1)		P15 M16 G17 I18 T19 L20 K21 R32 M34 V64 Q68
Enzymatic activity
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
External links
PDB RCSB:6nid, PDBe:6nid, PDBj:6nid
PDBsum6nid
PubMed
UniProtO14936|CSKP_HUMAN Peripheral plasma membrane protein CASK (Gene Name=CASK)

[Back to BioLiP]