Structure of PDB 6ncp Chain C Binding Site BS01

Receptor Information
>6ncp Chain C (length=229) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVESGGGVVQPGGSLRLSCAASGFAFKDFGMHWVRQAPGKGLEWVAV
IGGGHGQHQSYSESVKGRFAITRDNEKNKLYLHMDRLRTEDTAVYYCAKD
RLGRPWNIGGRLVYYYYGMDVWGQGTTVTVSSASTKGPSVFPLAPSSKGG
TAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTV
PSSSLGTQTYICNVNHKPSNTKVDKKVEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6ncp Conformational Plasticity in the HIV-1 Fusion Peptide Facilitates Recognition by Broadly Neutralizing Antibodies.
Resolution2.76 Å
Binding residue
(original residue number in PDB)		Q55 H56 N100B G100E R100F L100G V100H Y100I Y100J Y100K
Binding residue
(residue number reindexed from 1)		Q57 H58 N107 G110 R111 L112 V113 Y114 Y115 Y116
External links