Structure of PDB 6n3a Chain C Binding Site BS01

Receptor Information
>6n3a Chain C (length=50) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6n3a Cryo-EM structures of four polymorphic TDP-43 amyloid cores.
Resolution3.3 Å
Binding residue
(original residue number in PDB)
S332 M336
Binding residue
(residue number reindexed from 1)
S22 M26
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6n3a, PDBe:6n3a, PDBj:6n3a
PDBsum6n3a
PubMed31235914
UniProtQ13148|TADBP_HUMAN TAR DNA-binding protein 43 (Gene Name=TARDBP)

[Back to BioLiP]