Structure of PDB 6n3a Chain C Binding Site BS01

Receptor Information

>6n3a Chain C (length=50) Species: 9606 (Homo sapiens)

MNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQ

Ligand information

>6n3a Chain M (length=10) Species: 9606 (Homo sapiens)

GMLASQQNQS

Receptor-Ligand Complex Structure

Structure summary

• PDB: 6n3a Cryo-EM structures of four polymorphic TDP-43 amyloid cores.
• Resolution: 3.3 Å
• Binding residue (original residue number in PDB): S332 M336
• Binding residue (residue number reindexed from 1): S22 M26

External links

• PDB: RCSB:6n3a, PDBe:6n3a, PDBj:6n3a
• PDBsum: 6n3a
• PubMed: 31235914
• UniProt: Q13148|TADBP_HUMAN TAR DNA-binding protein 43 (Gene Name=TARDBP)