Structure of PDB 6myd Chain C Binding Site BS01

Receptor Information
>6myd Chain C (length=151) Species: 7955 (Danio rerio) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQT
PSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQHHIEVM
ETKPDLQAFQRPTVMRNPKGFGYVTFLHLQALRQRGFVKEDVLLVRCEVT
P
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6myd Modular Architecture of the STING C-Terminal Tail Allows Interferon and NF-kappa B Signaling Adaptation.
Resolution1.399 Å
Binding residue
(original residue number in PDB)		R416 F434 Q478 A479 R487 P489 K490 G491 F492 G493 Y494 V495 T496
Binding residue
(residue number reindexed from 1)		R45 F63 Q107 A108 R116 P118 K119 G120 F121 G122 Y123 V124 T125
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0004842 ubiquitin-protein transferase activity
GO:0005164 tumor necrosis factor receptor binding
Biological Process
GO:0016567 protein ubiquitination
GO:0043122 regulation of canonical NF-kappaB signal transduction

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6myd, PDBe:6myd, PDBj:6myd
PDBsum6myd
PubMed31018131
UniProtQ6IWL4|TRAF6_DANRE TNF receptor-associated factor 6 (Gene Name=traf6)

[Back to BioLiP]