Structure of PDB 6msg Chain C Binding Site BS01

Receptor Information
>6msg Chain C (length=396) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LEEGKAGSGLRQYYLSKIEELQLIVNDKSQNLRRLQAQRNELNAKVRLLR
EELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTP
NCRVALRNDSYTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKE
IKEVIELPVKHPELFEALGIAQPKGVLLYGPPGTGKTLLARAVAHHTDCT
FIRVSGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRLE
GGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDSALLRPGR
IDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVK
GVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK
Ligand information
>6msg Chain v (length=24) Species: 285006 (Saccharomyces cerevisiae RM11-1a) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6msg Cryo-EM structures and dynamics of substrate-engaged human 26S proteasome.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		F223 I224
Binding residue
(residue number reindexed from 1)		F213 I214
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005102 signaling receptor binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008134 transcription factor binding
GO:0016887 ATP hydrolysis activity
GO:0031531 thyrotropin-releasing hormone receptor binding
GO:0036402 proteasome-activating activity
GO:0140296 general transcription initiation factor binding
GO:0140297 DNA-binding transcription factor binding
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II
GO:0043069 negative regulation of programmed cell death
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
GO:1901800 positive regulation of proteasomal protein catabolic process
Cellular Component
GO:0000502 proteasome complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005838 proteasome regulatory particle
GO:0008540 proteasome regulatory particle, base subcomplex
GO:0016020 membrane
GO:0022624 proteasome accessory complex
GO:0031410 cytoplasmic vesicle
GO:0070062 extracellular exosome
GO:0072562 blood microparticle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6msg, PDBe:6msg, PDBj:6msg
PDBsum6msg
PubMed30479383
UniProtP62195|PRS8_HUMAN 26S proteasome regulatory subunit 8 (Gene Name=PSMC5)

[Back to BioLiP]