Structure of PDB 6msf Chain C Binding Site BS01

Receptor Information
>6msf Chain C (length=129) Species: 12022 (Escherichia phage MS2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQ
SSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSD
CELIVKAMQGLLKDGNPIPSAIAANSGIY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6msf Crystal structure of an RNA aptamer-protein complex at 2.8 A resolution.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		T45 C46 S47 T59 K61 Y85
Binding residue
(residue number reindexed from 1)		T45 C46 S47 T59 K61 Y85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005198 structural molecule activity
GO:0042802 identical protein binding
Biological Process
GO:0006417 regulation of translation
GO:1904972 negative regulation of viral translation
Cellular Component
GO:0019028 viral capsid
GO:0039617 T=3 icosahedral viral capsid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6msf, PDBe:6msf, PDBj:6msf
PDBsum6msf
PubMed9461079
UniProtP03612|CAPSD_BPMS2 Capsid protein

[Back to BioLiP]