Structure of PDB 6m6v Chain C Binding Site BS01

Receptor Information
>6m6v Chain C (length=132) Species: 211586 (Shewanella oneidensis MR-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NDIIINKIATIKRCIKRIQQVYGDGSQFKQDFTLQDSVILNLQRCCEACI
DIANHINRQQQLGIPQSSRDSFTLLAQNNLITQPLSDNLKKMVGLRNIAV
HDYQELNLDIVVHVVQHHLEDFEQFIDVIKAE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6m6v Novel polyadenylylation-dependent neutralization mechanism of the HEPN/MNT toxin/antitoxin system.
Resolution3.08 Å
Binding residue
(original residue number in PDB)
K92 L96 N98 I99 Y104 Q105 L107 N108 I111 H114
Binding residue
(residue number reindexed from 1)
K91 L95 N97 I98 Y103 Q104 L106 N107 I110 H113
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0003674 molecular_function
GO:0004519 endonuclease activity
GO:0004540 RNA nuclease activity
Biological Process
GO:0008150 biological_process
Cellular Component
GO:0005575 cellular_component
GO:0110001 toxin-antitoxin complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6m6v, PDBe:6m6v, PDBj:6m6v
PDBsum6m6v
PubMed33045733
UniProtQ8ECH6|HEPT_SHEON mRNA nuclease HepT (Gene Name=hepT)

[Back to BioLiP]