Structure of PDB 6m4h Chain C Binding Site BS01

Receptor Information
>6m4h Chain C (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLEL
AGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQV
Ligand information
>6m4h Chain I (length=103) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gtgcctggagactagggagtaatccccttggcggttaaaacgcgggggac
agcgcgtacgtgcgtttaagcggtgctagagctgtctacgaccaattgag
cgg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6m4h Structural basis of nucleosome dynamics modulation by histone variants H2A.B and H2A.Z.2.2.
Resolution3.9 Å
Binding residue
(original residue number in PDB)		R39 L47 S48 R49
Binding residue
(residue number reindexed from 1)		R20 L28 S29 R30
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
GO:0006397 mRNA processing
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0000791 euchromatin
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6m4h, PDBe:6m4h, PDBj:6m4h
PDBsum6m4h
PubMed33073403
UniProtP0C5Z0|H2AB2_HUMAN Histone H2A-Bbd type 2/3 (Gene Name=H2AB2)

[Back to BioLiP]