Structure of PDB 6m4d Chain C Binding Site BS01

Receptor Information
>6m4d Chain C (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEV
LELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAG
Ligand information
>6m4d Chain I (length=125) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cggtgccgaggccgctcaattggtcgtagacagctctagcaccgcttaaa
cgcacgtacgcgctgtcccccgcgttttaaccgccaaggggattactccc
tagtctccaggcacgtgtcagatat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6m4d Structural basis of nucleosome dynamics modulation by histone variants H2A.B and H2A.Z.2.2.
Resolution4.4 Å
Binding residue
(original residue number in PDB)		K37 R45 V46 R80
Binding residue
(residue number reindexed from 1)		K22 R30 V31 R65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6m4d, PDBe:6m4d, PDBj:6m4d
PDBsum6m4d
PubMed33073403
UniProtQ71UI9|H2AV_HUMAN Histone H2A.V (Gene Name=H2AZ2)

[Back to BioLiP]