Structure of PDB 6m3d Chain C Binding Site BS01

Receptor Information
>6m3d Chain C (length=108) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFKNKAA
RPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFKNK
AAKIKKSG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6m3d Structural basis for designing an array of engrailed homeodomains.
Resolution1.6 Å
Binding residue
(original residue number in PDB)		N45 T49 R51 R90 R92 T93 F95 Q131 I134 W135 N138 K142
Binding residue
(residue number reindexed from 1)		N19 T23 R25 R51 R53 T54 F56 Q92 I95 W96 N99 K103
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6m3d, PDBe:6m3d, PDBj:6m3d
PDBsum6m3d
PubMed32876058
UniProtP02836|HMEN_DROME Segmentation polarity homeobox protein engrailed (Gene Name=en)

[Back to BioLiP]