Structure of PDB 6lbm Chain C Binding Site BS01

Receptor Information
>6lbm Chain C (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSI
RHNLSLNECFVKVPRDDKKGSYWTLDPDSYNMFENGSFLRRRRRF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lbm Mechanism of forkhead transcription factors binding to a novel palindromic DNA site.
Resolution2.841 Å
Binding residue
(original residue number in PDB)		K72 S76 Y77 I78 N118 H122 R164
Binding residue
(residue number reindexed from 1)		K2 S6 Y7 I8 N48 H52 R91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6lbm, PDBe:6lbm, PDBj:6lbm
PDBsum6lbm
PubMed33577686
UniProtQ99958|FOXC2_HUMAN Forkhead box protein C2 (Gene Name=FOXC2)

[Back to BioLiP]