Structure of PDB 6lb5 Chain C Binding Site BS01

Receptor Information
>6lb5 Chain C (length=220) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DMPVERILEAELAVEPKTETYVEANDPVTNICQAADKQLFTLVEWAKRIP
HFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSA
HSAGVGAIFDRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPA
EVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLF
FFKLIGDTPIDTFLMEMLEA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lb5 Crystal structure of dimeric RXR-LBD complexed with full agonist NEt-3IB and TIF2 co-activator
Resolution2.4 Å
Binding residue
(original residue number in PDB)		F277 V280 K284 V298 R302 T449 E453
Binding residue
(residue number reindexed from 1)		F40 V43 K47 V61 R65 T212 E216
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003707 nuclear steroid receptor activity
GO:0008270 zinc ion binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6lb5, PDBe:6lb5, PDBj:6lb5
PDBsum6lb5
PubMed
UniProtP19793|RXRA_HUMAN Retinoic acid receptor RXR-alpha (Gene Name=RXRA)

[Back to BioLiP]