Structure of PDB 6laz Chain C Binding Site BS01

Receptor Information
>6laz Chain C (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVKRSLKMRGQAF
VIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
Ligand information
>6laz Chain B (length=55) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcauugugccucgcauugcacuccgcggggcgauaaguccugaaaaggg
auguc
.<<<<<.<<<<<<<<..........>>>>>>>>......<<<....>>>>
>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6laz SAM-VI riboswitch structure and signature for ligand discrimination.
Resolution2.76 Å
Binding residue
(original residue number in PDB)
Y13 N15 N16 E19 K22 K23 S48 K50 M51 R52 Q54 F56 K80 R83 Q85 K88 S91 D92
Binding residue
(residue number reindexed from 1)
Y7 N9 N10 E13 K16 K17 S42 K44 M45 R46 Q48 F50 K74 R77 Q79 K82 S85 D86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6laz, PDBe:6laz, PDBj:6laz
PDBsum6laz
PubMed31844059
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]