Structure of PDB 6lau Chain C Binding Site BS01

Receptor Information
>6lau Chain C (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVKRSLKMRGQA
FVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Ligand information
>6lau Chain B (length=55) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcauugugccucgcauugcacuccgcggggcgauaaguccugaaaaggg
auguc
.<<<<<.<<<<<<<<..........>>>>>>>>......<<<....>>>>
>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6lau SAM-VI riboswitch structure and signature for ligand discrimination.
Resolution3.109 Å
Binding residue
(original residue number in PDB)		Y13 N15 N16 E19 K22 K23 D24 R47 S48 L49 K50 M51 R52 Q54 F56 K80 R83 Q85 A87 K88 D90 S91 D92
Binding residue
(residue number reindexed from 1)		Y8 N10 N11 E14 K17 K18 D19 R42 S43 L44 K45 M46 R47 Q49 F51 K75 R78 Q80 A82 K83 D85 S86 D87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6lau, PDBe:6lau, PDBj:6lau
PDBsum6lau
PubMed31844059
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]