Structure of PDB 6l63 Chain C Binding Site BS01

Receptor Information
>6l63 Chain C (length=229) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAPED
LTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDAD
GSCALLSPYVQPVCLPSGAARCQVAGWGHQFEGAEEYASFLQEAQVPFLS
LERCSAPDVHGSSILPGMLCAGFLEGGTDACQGDSGGPLVCRLTLQGIIS
WGSGCGDRNKPGVYTDVAYYLAWIREHTV
Ligand information
>6l63 Chain D (length=18) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YFAYDRRKLSNNKRNYCG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6l63 Ribosomal synthesis and de novo discovery of bioactive foldamer peptides containing cyclic beta-amino acids.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		W392 S395 H412 V456 Y458 H507 Y515 H538 S541 D557 A558 C559 Q560 G561 S563 S585 W586 G587 S588
Binding residue
(residue number reindexed from 1)		W20 S23 H40 V84 Y86 H129 Y137 H160 S163 D179 A180 C181 Q182 G183 S185 S200 W201 G202 S203
Enzymatic activity
Catalytic site (original residue number in PDB) H412 D461 Q560 G561 D562 S563
Catalytic site (residue number reindexed from 1) H40 D89 Q182 G183 D184 S185
Enzyme Commision number 3.4.21.38: coagulation factor XIIa.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6l63, PDBe:6l63, PDBj:6l63
PDBsum6l63
PubMed32839601
UniProtP00748|FA12_HUMAN Coagulation factor XII (Gene Name=F12)

[Back to BioLiP]