Structure of PDB 6l4u Chain C Binding Site BS01

Receptor Information
>6l4u Chain C (length=80) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHTVKIYDTCIGCTQCVRACPTDVLEMVPWDGCKSGQIASSPRVEDCVGC
KRCETACPTDFLSVRVYLGAETTRSLGLAY
Ligand information
Ligand IDSF4
InChIInChI=1S/4Fe.4S
InChIKeyLJBDFODJNLIPKO-UHFFFAOYSA-N
SMILES
SoftwareSMILES
OpenEye OEToolkits 2.0.7[S]12[Fe]3[S]4[Fe]1[S]5[Fe]2[S]3[Fe]45
CACTVS 3.385S1[Fe]S[Fe]1.S2[Fe]S[Fe]2
FormulaFe4 S4
NameIRON/SULFUR CLUSTER
ChEMBL
DrugBank
ZINC
PDB chain6l4u Chain C Residue 101 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6l4u Structure of photosystem I-light-harvesting supercomplex from a red-lineage diatom
Resolution2.4 Å
Binding residue
(original residue number in PDB)		C21 P22 V25 L26 C48 V49 G50 C51 K52 R53 C54 V67
Binding residue
(residue number reindexed from 1)		C20 P21 V24 L25 C47 V48 G49 C50 K51 R52 C53 V66
Annotation score4
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Thu Feb 20 06:25:40 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1435     title=pdb2title(pdbid)
   1436     if bs.startswith("BS"):
=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)
   1438     else:
   1439         if lig3:
pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '6l4u', asym_id = 'C', bs = 'BS01', title = 'Structure of photosystem I-light-harvesting supercomplex from a red-lineage diatom'
 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='6l4u', asym_id='C', bs='BS01', title='Structure of photosystem I-light-harvesting supercomplex from a red-lineage diatom')
   1295         display_ec(ec,csaOrig,csaRenu)
   1296     if go:
=> 1297         display_go(go,uniprot,pdbid,asym_id)
   1298     return pubmed,uniprot
   1299 
global display_go = <function display_go>, go = '0009055,0009522,0009773,0015979,0042651,0051539', uniprot = '', pdbid = '6l4u', asym_id = 'C'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0009055,0009522,0009773,0015979,0042651,0051539', uniprot='', pdbid='6l4u', asym_id='C')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>