Structure of PDB 6kmf Chain C Binding Site BS01

Receptor Information
>6kmf Chain C (length=337) Species: 431947 (Porphyromonas gingivalis ATCC 33277) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFGVGDDESKVAKLTVMVYNGEQQEAIKSAENATKVEDIKCSAGQRTLVV
MANTGAMELVGKTLAEVKALTTELTAENQEAAGLIMTAEPKTIVLKAGKN
YIGYSGTGEGNHIENDPLKIKRVHARMAFTEIKVQMSAAYDNIYTFVPEK
IYGLIAKKQSNLFGATLVNADANYLTGSLTTFNGAYTPANYANVPWLSRN
YVAPAADAPQGFYVLENDYSANGGTIHPTILCVYGKLQKNGADLAGADLA
AAQAANWVDAEGKTYYPVLVNFNSNNYTYDSNYTPKNKIERNHKYDIKLT
ITGPGTNNPENPITESAHLNVQCTVAEWVLVGQNATW
Ligand information
>6kmf Chain D (length=21) Species: 431947 (Porphyromonas gingivalis ATCC 33277) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AHLNVQCTVAEWVLVGQNATW
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kmf Structure of polymerized type V pilin reveals assembly mechanism involving protease-mediated strand exchange.
Resolution3.6 Å
Binding residue
(original residue number in PDB)
L60 T80 V82 E83 I85 K86 C87 A143 N146 Y147 I148 Y150 L164 K165 I166 R168 P313 N322 Y323 T324 Y325 D326 Y329 N338 H339 K340 Y341 D342 I343 K344 T346 T348 P350 I359
Binding residue
(residue number reindexed from 1)
L14 T34 V36 E37 I39 K40 C41 A97 N100 Y101 I102 Y104 L118 K119 I120 R122 P267 N276 Y277 T278 Y279 D280 Y283 N292 H293 K294 Y295 D296 I297 K298 T300 T302 P304 I313
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005198 structural molecule activity
Biological Process
GO:0007155 cell adhesion
Cellular Component
GO:0009279 cell outer membrane
GO:0009289 pilus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6kmf, PDBe:6kmf, PDBj:6kmf
PDBsum6kmf
PubMed32284566
UniProtB2RH54|FIMA1_PORG3 Major fimbrium subunit FimA type-1 (Gene Name=fimA)

[Back to BioLiP]