Structure of PDB 6klb Chain C Binding Site BS01

Receptor Information
>6klb Chain C (length=117) Species: 386891 (Moraxella bovoculi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HNDEMYLVVQALIRACIIKEIDLYTEQLYNIIKSLPYDKRPNVVYSDQPL
DPNNLDLSEPELWAEQVGECMRYAHNDQPCFYIGSTKRELRVNYIVPVIG
VRDEIERVMTLEEVRNL
Ligand information
>6klb Chain E (length=25) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aauuucuacuaaguguagaucgguc
....<<<<<.....>>>>>......
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6klb Structural insight into multistage inhibition of CRISPR-Cas12a by AcrVA4.
Resolution4.1 Å
Binding residue
(original residue number in PDB)		T201 K202
Binding residue
(residue number reindexed from 1)		T86 K87
External links