Structure of PDB 6kc4 Chain C Binding Site BS01

Receptor Information
>6kc4 Chain C (length=100) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPLAEQDWYHGAIPRIEAQELLKKQGDFLVRESHGKPGEYVLSVYSDGQR
RHFIIQYVDNMYRFEGTGFSNIPQLIDHHYTTKQVITKKSGVVLLNPIPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6kc4 High-resolution structural analysis shows how different crystallographic environments can induce alternative modes of binding of a phosphotyrosine peptide to the SH2 domain of Fer tyrosine kinase.
Resolution1.37 Å
Binding residue
(original residue number in PDB)
Y509 N512
Binding residue
(residue number reindexed from 1)
Y57 N60
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:6kc4, PDBe:6kc4, PDBj:6kc4
PDBsum6kc4
PubMed31441171
UniProtP16591|FER_HUMAN Tyrosine-protein kinase Fer (Gene Name=FER)

[Back to BioLiP]