Structure of PDB 6jzn Chain C Binding Site BS01

Receptor Information
>6jzn Chain C (length=133) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPMDTEEAEELVRQWENVKAEALGPTHQVYSLSEVLDESMLVQWQTLAQT
AEAKSCYWRFVLLHLEVLQAHIFEDGIAGEAAEIEALLEEAAELVDESQP
KNAKYYSTYKIRYILKKQEDGLWKFCQSDIQIQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6jzn Structure of PARC6 and PDV1 complex from Arabidopsis thaliana
Resolution2.894 Å
Binding residue
(original residue number in PDB)
W700 E701 K704 W729 W743 F745 L779 D781 Y790 Y794 I796 Y798 I815 I817
Binding residue
(residue number reindexed from 1)
W15 E16 K19 W44 W58 F60 L94 D96 Y105 Y109 I111 Y113 I130 I132
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6jzn, PDBe:6jzn, PDBj:6jzn
PDBsum6jzn
PubMed
UniProtQ8VY16|CDP1_ARATH Plastid division protein CDP1, chloroplastic (Gene Name=CDP1)

[Back to BioLiP]